Lineage for d2c0uc2 (2c0u C:2-260)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621090Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2621091Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2621092Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2621167Protein Nitroalkane oxidase [144026] (1 species)
  7. 2621168Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (2 PDB entries)
    Uniprot Q8X1D8 2-260
  8. 2621171Domain d2c0uc2: 2c0u C:2-260 [129612]
    Other proteins in same PDB: d2c0ua1, d2c0ub1, d2c0uc1, d2c0ud1
    automated match to d2c0ua2
    complexed with fad, nbt

Details for d2c0uc2

PDB Entry: 2c0u (more details), 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d2c0uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0uc2 e.6.1.1 (C:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOPe Domain Coordinates for d2c0uc2:

Click to download the PDB-style file with coordinates for d2c0uc2.
(The format of our PDB-style files is described here.)

Timeline for d2c0uc2: