Lineage for d2byzc1 (2byz C:1-253)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392125Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1392146Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1392147Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 1392216Domain d2byzc1: 2byz C:1-253 [129526]
    automatically matched to d1dd8a1
    complexed with dao, nh4; mutant

Details for d2byzc1

PDB Entry: 2byz (more details), 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byzc1 c.95.1.1 (C:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2byzc1:

Click to download the PDB-style file with coordinates for d2byzc1.
(The format of our PDB-style files is described here.)

Timeline for d2byzc1: