Lineage for d2bweu_ (2bwe U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540228Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries)
  8. 2540240Domain d2bweu_: 2bwe U: [129362]
    Other proteins in same PDB: d2bwea1, d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwes1
    automated match to d2bwfa_

Details for d2bweu_

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (U:) dsk2

SCOPe Domain Sequences for d2bweu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bweu_ d.15.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

SCOPe Domain Coordinates for d2bweu_:

Click to download the PDB-style file with coordinates for d2bweu_.
(The format of our PDB-style files is described here.)

Timeline for d2bweu_: