Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries) |
Domain d2bweu_: 2bwe U: [129362] Other proteins in same PDB: d2bwea1, d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwes1 automated match to d2bwfa_ |
PDB Entry: 2bwe (more details), 3.1 Å
SCOPe Domain Sequences for d2bweu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bweu_ d.15.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi qdghsvhlvksq
Timeline for d2bweu_: