Lineage for d2brpa1 (2brp A:170-540)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722452Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2722470Protein Hyaluronate lyase [48237] (2 species)
  7. 2722471Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [48238] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2722483Domain d2brpa1: 2brp A:170-540 [129005]
    Other proteins in same PDB: d2brpa2, d2brpa3
    automated match to d1w3ya1
    complexed with sie, so4, xls

Details for d2brpa1

PDB Entry: 2brp (more details), 2 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with w249b
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d2brpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brpa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOPe Domain Coordinates for d2brpa1:

Click to download the PDB-style file with coordinates for d2brpa1.
(The format of our PDB-style files is described here.)

Timeline for d2brpa1: