Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) |
Domain d2bq1j1: 2bq1 J:6-286 [128958] Other proteins in same PDB: d2bq1e1, d2bq1e2, d2bq1f1, d2bq1f2 automatically matched to d2r2fa_ protein/DNA complex; complexed with dgt, fe, mg |
PDB Entry: 2bq1 (more details), 4 Å
SCOPe Domain Sequences for d2bq1j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq1j1 a.25.1.2 (J:6-286) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg wvndvkaflcynankalmnlgyealfppemadvnpailaal
Timeline for d2bq1j1: