Lineage for d2bkbb1 (2bkb B:201-282)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303784Protein automated matches [227044] (3 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255056] (1 PDB entry)
  8. 2303790Domain d2bkbb1: 2bkb B:201-282 [128669]
    Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
    automated match to d1isca1
    complexed with fe2

Details for d2bkbb1

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkbb1 a.2.11.1 (B:201-282) automated matches {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

SCOPe Domain Coordinates for d2bkbb1:

Click to download the PDB-style file with coordinates for d2bkbb1.
(The format of our PDB-style files is described here.)

Timeline for d2bkbb1: