Lineage for d2bk0a1 (2bk0 A:2-154)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582037Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2582044Protein Major allergen api g 1 [143819] (1 species)
  7. 2582045Species Celery (Apium graveolens) [TaxId:4045] [143820] (1 PDB entry)
    Uniprot P49372 2-154
  8. 2582046Domain d2bk0a1: 2bk0 A:2-154 [128646]
    Other proteins in same PDB: d2bk0b_

Details for d2bk0a1

PDB Entry: 2bk0 (more details), 2.9 Å

PDB Description: crystal structure of the major celery allergen api g 1
PDB Compounds: (A:) major allergen api g 1

SCOPe Domain Sequences for d2bk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian

SCOPe Domain Coordinates for d2bk0a1:

Click to download the PDB-style file with coordinates for d2bk0a1.
(The format of our PDB-style files is described here.)

Timeline for d2bk0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bk0b_