Lineage for d2bhia_ (2bhi A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2636875Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2636968Protein Cardiotoxin III [57337] (1 species)
  7. 2636969Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57338] (6 PDB entries)
    Uniprot P60301 22-81
  8. 2636973Domain d2bhia_: 2bhi A: [128531]
    automated match to d1h0ja_
    complexed with c10, sft

Details for d2bhia_

PDB Entry: 2bhi (more details), 2.31 Å

PDB Description: crystal structure of taiwan cobra cardiotoxin a3 complexed with sulfogalactoceramide
PDB Compounds: (A:) cytotoxin 3

SCOPe Domain Sequences for d2bhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhia_ g.7.1.1 (A:) Cardiotoxin III {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn

SCOPe Domain Coordinates for d2bhia_:

Click to download the PDB-style file with coordinates for d2bhia_.
(The format of our PDB-style files is described here.)

Timeline for d2bhia_: