SCOPe 2.07: Domain d2bevb1: 2bev B:2-204

Lineage for d2bevb1 (2bev B:2-204)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries)
   Uniprot P21953 52-392

8. Domain d2bevb1: 2bev B:2-204 [128393]
   Other proteins in same PDB: d2beva_, d2bevb2
   automated match to d1v16b1
   complexed with cl, gol, k, mn, thy

Details for d2bevb1

PDB Entry: 2bev, 1.8 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch

PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bevb1:

Sequence, based on SEQRES records:

>d2bevb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records):

>d2bevb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie

Timeline for d2bevb1:

• d2bevb1 first appeared in SCOP 1.73
  
• d2bevb1 appears in SCOPe 2.06
  
• d2bevb1 appears in the current release, SCOPe 2.08