Lineage for d2b9oc1 (2b9o C:2-106)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554177Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2554178Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2554194Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 2554224Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
    Uniprot P80372
  8. 2554258Domain d2b9oc1: 2b9o C:2-106 [128163]
    Other proteins in same PDB: d2b9ob1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    protein/RNA complex
    protein/RNA complex

Details for d2b9oc1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2b9oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9oc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOPe Domain Coordinates for d2b9oc1:

Click to download the PDB-style file with coordinates for d2b9oc1.
(The format of our PDB-style files is described here.)

Timeline for d2b9oc1: