Lineage for d2b9n31 (2b9n 3:1-60)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655592Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1655593Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1655594Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1655637Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 1655675Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 1655687Domain d2b9n31: 2b9n 3:1-60 [128147]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to d1bxya_

Details for d2b9n31

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (3:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2b9n31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9n31 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2b9n31:

Click to download the PDB-style file with coordinates for d2b9n31.
(The format of our PDB-style files is described here.)

Timeline for d2b9n31: