Lineage for d2b8kg2 (2b8k G:1-80)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613890Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) (S)
    automatically mapped to Pfam PF03876
  5. 2613891Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)
  6. 2613892Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)
  7. 2613893Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)
    Uniprot P34087
  8. 2613901Domain d2b8kg2: 2b8k G:1-80 [128085]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1y14b2
    complexed with zn

Details for d2b8kg2

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (G:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d2b8kg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8kg2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

SCOPe Domain Coordinates for d2b8kg2:

Click to download the PDB-style file with coordinates for d2b8kg2.
(The format of our PDB-style files is described here.)

Timeline for d2b8kg2: