Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RPB3 [64462] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d2b63c2: 2b63 C:42-172 [127920] Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1 automatically matched to d1i3qc2 protein/RNA complex; complexed with mg, zn |
PDB Entry: 2b63 (more details), 3.8 Å
SCOPe Domain Sequences for d2b63c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b63c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d2b63c2: