Lineage for d2b63c2 (2b63 C:42-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684463Protein RPB3 [64462] (2 species)
  7. 1684464Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1684482Domain d2b63c2: 2b63 C:42-172 [127920]
    Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1
    automatically matched to d1i3qc2
    protein/RNA complex; complexed with mg, zn

Details for d2b63c2

PDB Entry: 2b63 (more details), 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2b63c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b63c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2b63c2:

Click to download the PDB-style file with coordinates for d2b63c2.
(The format of our PDB-style files is described here.)

Timeline for d2b63c2: