Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RPB3 [64315] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d2b63c1: 2b63 C:3-37,C:173-268 [127919] Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1 automatically matched to d1i3qc1 protein/RNA complex; complexed with mg, zn |
PDB Entry: 2b63 (more details), 3.8 Å
SCOPe Domain Sequences for d2b63c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b63c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva sillaltqmdqd
Timeline for d2b63c1: