SCOPe 2.04: Domain d2ayxa2: 2ayx A:700-816

Lineage for d2ayxa2 (2ayx A:700-816)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.6: RcsC linker domain-like [142037] (1 protein)
   PfamB PB016190; probable rudiment CheY-like domain; precedes the C-terminal CheY-related domain of similar structure
   automatically mapped to Pfam PF09456

6. Protein Sensor kinase protein RcsC [142038] (1 species)

7. Species Escherichia coli [TaxId:562] [142039] (2 PDB entries)
   Uniprot P14376 700-816

8. Domain d2ayxa2: 2ayx A:700-816 [127575]
   Other proteins in same PDB: d2ayxa1

Details for d2ayxa2

PDB Entry: 2ayx

PDB Description: solution structure of the e.coli rcsc c-terminus (residues 700-949) containing linker region and phosphoreceiver domain

PDB Compounds: (A:) Sensor kinase protein rcsC

SCOPe Domain Sequences for d2ayxa2:

Sequence; same for both SEQRES and ATOM records:

>d2ayxa2 c.23.1.6 (A:700-816) Sensor kinase protein RcsC {Escherichia coli [TaxId: 562]}
gveglsgkrcwlavrnaslcqfletslqrsgivvttyegqeptpedvlitdevvskkwqg
ravvtfcrrhigiplekapgewvhsvaaphelpallariyliemesddpanalpstd

Timeline for d2ayxa2:

• d2ayxa2 first appeared in SCOP 1.73
  
• d2ayxa2 appears in SCOPe 2.03
  
• d2ayxa2 appears in SCOPe 2.05
  
• d2ayxa2 appears in the current release, SCOPe 2.08