SCOPe 2.03: Domain d2axzc1: 2axz C:2-68

Lineage for d2axzc1 (2axz C:2-68)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
   Uniprot Q04114 1-69! Uniprot Q04114 2-66

8. Domain d2axzc1: 2axz C:2-68 [127540]
   Other proteins in same PDB: d2axza2, d2axzb2, d2axzc2, d2axzd2
   automatically matched to 2AW6 A:1-69
   protein/DNA complex

Details for d2axzc1

PDB Entry: 2axz, 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex

PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2axzc1:

Sequence; same for both SEQRES and ATOM records:

>d2axzc1 a.35.1.11 (C:2-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnragmn

Timeline for d2axzc1:

• d2axzc1 first appeared in SCOP 1.73
  
• d2axzc1 appears in SCOPe 2.02
  
• d2axzc1 appears in SCOPe 2.04
  
• d2axzc1 appears in the current release, SCOPe 2.08