Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
Domain d2axzc1: 2axz C:2-68 [127540] Other proteins in same PDB: d2axza2, d2axzb2, d2axzc2, d2axzd2 automatically matched to 2AW6 A:1-69 protein/DNA complex |
PDB Entry: 2axz (more details), 3 Å
SCOPe Domain Sequences for d2axzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axzc1 a.35.1.11 (C:2-68) PrgX {Enterococcus faecalis [TaxId: 1351]} fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei lnragmn
Timeline for d2axzc1: