SCOPe 2.03: Domain d2awoa1: 2awo A:236-373

Lineage for d2awoa1 (2awo A:236-373)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.6: MOP-like [50331] (3 families)
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
probably stems out from the biMOP domain
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
Species Escherichia coli [TaxId:562] [101772] (13 PDB entries)
Domain d2awoa1: 2awo A:236-373 [127467]
Other proteins in same PDB: d2awoa2, d2awob2, d2awoc2, d2awod2
automated match to d1q12a1
complexed with adp, mg

Details for d2awoa1

PDB Entry: 2awo (more details), 2.8 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)

PDB Compounds: (A:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awoa1 b.40.6.3 (A:236-373) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgvas

SCOPe Domain Coordinates for d2awoa1:

Click to download the PDB-style file with coordinates for d2awoa1.
(The format of our PDB-style files is described here.)

Timeline for d2awoa1: