Lineage for d2awnd2 (2awn D:2-235)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596847Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1596963Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 1596964Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 1596974Domain d2awnd2: 2awn D:2-235 [127466]
    Other proteins in same PDB: d2awna1, d2awnb1, d2awnc1, d2awnd1
    automated match to d1q12a2
    complexed with adp, mg

Details for d2awnd2

PDB Entry: 2awn (more details), 2.3 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)
PDB Compounds: (D:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awnd2:

Sequence, based on SEQRES records: (download)

>d2awnd2 c.37.1.12 (D:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Sequence, based on observed residues (ATOM records): (download)

>d2awnd2 c.37.1.12 (D:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvepsvflldeplsnldaalrvqmrieisrlhkrlgrtmiyvt
hdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d2awnd2:

Click to download the PDB-style file with coordinates for d2awnd2.
(The format of our PDB-style files is described here.)

Timeline for d2awnd2: