SCOPe 2.07: Domain d2aw2y1: 2aw2 Y:2-59

Lineage for d2aw2y1 (2aw2 Y:2-59)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Cellular receptor HveA [64568] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries)

8. Domain d2aw2y1: 2aw2 Y:2-59 [127391]
   Other proteins in same PDB: d2aw2a1, d2aw2a2, d2aw2x2, d2aw2x3
   automated match to d1jmab1
   complexed with ni

Details for d2aw2y1

PDB Entry: 2aw2, 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex

PDB Compounds: (Y:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d2aw2y1:

Sequence; same for both SEQRES and ATOM records:

>d2aw2y1 g.24.1.1 (Y:2-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
psckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

Timeline for d2aw2y1:

• d2aw2y1 first appeared in SCOP 1.73
  
• d2aw2y1 appears in SCOPe 2.06
  
• d2aw2y1 appears in the current release, SCOPe 2.08