SCOPe 2.08: Domain d2atkc_: 2atk C:

Lineage for d2atkc_ (2atk C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d2atkc_: 2atk C: [127295]
   Other proteins in same PDB: d2atka1, d2atka2, d2atka3, d2atkb1, d2atkb2
   automated match to d2p7tc_
   complexed with f09, k; mutant

Details for d2atkc_

PDB Entry: 2atk, 2.5 Å

PDB Description: structure of a mutant kcsa k+ channel

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2atkc_:

Sequence; same for both SEQRES and ATOM records:

>d2atkc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2atkc_:

• d2atkc_ first appeared in SCOP 1.73, called d2atkc1
  
• d2atkc_ appears in SCOPe 2.07