| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein automated matches [190184] (3 species) not a true protein |
| Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
| Domain d2atkc_: 2atk C: [127295] Other proteins in same PDB: d2atka1, d2atka2, d2atka3, d2atkb1, d2atkb2 automated match to d2p7tc_ complexed with f09, k; mutant |
PDB Entry: 2atk (more details), 2.5 Å
SCOPe Domain Sequences for d2atkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atkc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2atkc_: