Lineage for d2assc_ (2ass C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967091Protein CksHs1 [55645] (1 species)
  7. 2967092Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 2967095Domain d2assc_: 2ass C: [127272]
    Other proteins in same PDB: d2assa1, d2assa2, d2assb1, d2assb2
    automated match to d1dksb_
    complexed with ben, po4

Details for d2assc_

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 1

SCOPe Domain Sequences for d2assc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2assc_ d.97.1.1 (C:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrpl

SCOPe Domain Coordinates for d2assc_:

Click to download the PDB-style file with coordinates for d2assc_.
(The format of our PDB-style files is described here.)

Timeline for d2assc_: