Lineage for d2aoaa_ (2aoa A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572000Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2572001Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2572048Domain d2aoaa_: 2aoa A: [127075]
    automated match to d1fhs__
    complexed with p33, s1s

Details for d2aoaa_

PDB Entry: 2aoa (more details), 1.99 Å

PDB Description: crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the grb2 sh2 domain
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d2aoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoaa_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrd

SCOPe Domain Coordinates for d2aoaa_:

Click to download the PDB-style file with coordinates for d2aoaa_.
(The format of our PDB-style files is described here.)

Timeline for d2aoaa_: