Lineage for d2ajra2 (2ajr A:1-319)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2511781Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2511849Protein Putative sugar kinase TM0828 [82518] (1 species)
  7. 2511850Species Thermotoga maritima [TaxId:2336] [82519] (1 PDB entry)
  8. 2511851Domain d2ajra2: 2ajr A:1-319 [126892]
    Other proteins in same PDB: d2ajra3, d2ajrb3
    automated match to d1o14a_
    complexed with act, mg

Details for d2ajra2

PDB Entry: 2ajr (more details), 2.46 Å

PDB Description: crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
PDB Compounds: (A:) sugar kinase, pfkB family

SCOPe Domain Sequences for d2ajra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajra2 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]}
mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg
fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd
vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy
egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre
gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym
pdleaikkeydhftvervk

SCOPe Domain Coordinates for d2ajra2:

Click to download the PDB-style file with coordinates for d2ajra2.
(The format of our PDB-style files is described here.)

Timeline for d2ajra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ajra3