SCOPe 2.03: Domain d2ajdc1: 2ajd C:39-508

Lineage for d2ajdc1 (2ajd C:39-508)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)

8. Domain d2ajdc1: 2ajd C:39-508 [126878]
   Other proteins in same PDB: d2ajda2, d2ajdb2, d2ajdc2, d2ajdd2
   automated match to d1orva1
   complexed with bpr, nag, so4

Details for d2ajdc1

PDB Entry: 2ajd, 2.56 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with l-pro-boro-l- pro (boropro)

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2ajdc1:

Sequence; same for both SEQRES and ATOM records:

>d2ajdc1 b.70.3.1 (C:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

Timeline for d2ajdc1:

• d2ajdc1 first appeared in SCOP 1.73
  
• d2ajdc1 appears in SCOPe 2.02
  
• d2ajdc1 appears in SCOPe 2.04
  
• d2ajdc1 appears in the current release, SCOPe 2.08