Class b: All beta proteins [48724] (174 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries) |
Domain d2ajcb1: 2ajc B:39-508 [126868] Other proteins in same PDB: d2ajca2, d2ajcb2, d2ajcc2, d2ajcd2 automated match to d1orva1 complexed with aes, nag, so4 |
PDB Entry: 2ajc (more details), 1.95 Å
SCOPe Domain Sequences for d2ajcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajcb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq
Timeline for d2ajcb1: