SCOPe 2.04: Domain d2ahdb_: 2ahd B:

Lineage for d2ahdb_ (2ahd B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein automated matches [254477] (1 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [255030] (1 PDB entry)

8. Domain d2ahdb_: 2ahd B: [126753]
   automated match to d1s3la_

Details for d2ahdb_

PDB Entry: 2ahd, 3 Å

PDB Description: The Apo structure of Methanococcus jannaschii phosphodiesterase MJ0936

PDB Compounds: (B:) Phosphodiesterase MJ0936

SCOPe Domain Sequences for d2ahdb_:

Sequence; same for both SEQRES and ATOM records:

>d2ahdb_ d.159.1.7 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

Timeline for d2ahdb_:

• d2ahdb_ first appeared in SCOP 1.73, called d2ahdb1
  
• d2ahdb_ was called d2ahdb1 in SCOPe 2.03
  
• d2ahdb_ appears in SCOPe 2.05
  
• d2ahdb_ appears in the current release, SCOPe 2.08