Lineage for d2agsa1 (2ags A:404-631)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391054Species Trypanosoma rangeli [TaxId:5698] [255027] (3 PDB entries)
  8. 2391055Domain d2agsa1: 2ags A:404-631 [126737]
    Other proteins in same PDB: d2agsa2, d2agsa3
    automated match to d1n1ta1
    complexed with fkd, so4

Details for d2agsa1

PDB Entry: 2ags (more details), 1.7 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2-keto-3-deoxy-d- glycero-d-galacto-2,3-difluoro-nononic acid (2,3-difluoro-kdn)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2agsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agsa1 b.29.1.0 (A:404-631) automated matches {Trypanosoma rangeli [TaxId: 5698]}
tppskggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvggga
vwpvarqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknr
qwrplygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdis
hfyiggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOPe Domain Coordinates for d2agsa1:

Click to download the PDB-style file with coordinates for d2agsa1.
(The format of our PDB-style files is described here.)

Timeline for d2agsa1: