SCOPe 2.08: Domain d2adfa_: 2adf A:

Lineage for d2adfa_ (2adf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein automated matches [190060] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)

8. Domain d2adfa_: 2adf A: [126584]
   Other proteins in same PDB: d2adfh_, d2adfl1, d2adfl2
   automated match to d1fe8c_
   complexed with acy, gol, so4

Details for d2adfa_

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d2adfa_:

Sequence; same for both SEQRES and ATOM records:

>d2adfa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

Timeline for d2adfa_:

• d2adfa_ first appeared in SCOP 1.73, called d2adfa1
  
• d2adfa_ appears in SCOPe 2.07