SCOPe 2.07: Domain d2adca1: 2adc A:335-443

Lineage for d2adca1 (2adc A:335-443)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Polypyrimidine tract-binding protein [54950] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
   Uniprot P26599 54-141, 177-284, 335-531

8. Domain d2adca1: 2adc A:335-443 [126582]
   automatically matched to d1qm9a1
   protein/RNA complex

Details for d2adca1

PDB Entry: 2adc

PDB Description: solution structure of polypyrimidine tract binding protein rbd34 complexed with cucucu rna

PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d2adca1:

Sequence; same for both SEQRES and ATOM records:

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
gnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamshl
nghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgs

Timeline for d2adca1:

• d2adca1 first appeared in SCOP 1.73
  
• d2adca1 appears in SCOPe 2.06
  
• d2adca1 appears in the current release, SCOPe 2.08