Lineage for d2a61d_ (2a61 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307134Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2307234Protein automated matches [190294] (6 species)
    not a true protein
  7. 2307253Species Thermotoga maritima [TaxId:2336] [187380] (1 PDB entry)
  8. 2307256Domain d2a61d_: 2a61 D: [126190]
    Other proteins in same PDB: d2a61a1
    automated match to d2a61a1

Details for d2a61d_

PDB Entry: 2a61 (more details), 1.8 Å

PDB Description: The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
PDB Compounds: (D:) transcriptional regulator Tm0710

SCOPe Domain Sequences for d2a61d_:

Sequence, based on SEQRES records: (download)

>d2a61d_ a.4.5.28 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
sskildylkelkgvmernfsk

Sequence, based on observed residues (ATOM records): (download)

>d2a61d_ a.4.5.28 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
vtglvkrleadgyltrtpdrayflvitrkgeeviekvierrenfiekitsdlgkeksski
ldylkelkgvmernfsk

SCOPe Domain Coordinates for d2a61d_:

Click to download the PDB-style file with coordinates for d2a61d_.
(The format of our PDB-style files is described here.)

Timeline for d2a61d_: