Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255025] (1 PDB entry) |
Domain d2a5ya_: 2a5y A: [126183] Other proteins in same PDB: d2a5yb1, d2a5yb2, d2a5yb3, d2a5yc1, d2a5yc2 automated match to d1ohua_ complexed with atp, mg |
PDB Entry: 2a5y (more details), 2.6 Å
SCOPe Domain Sequences for d2a5ya_:
Sequence, based on SEQRES records: (download)
>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk haenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmm esvelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae
>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk haenfetfseqllavprisfslyqdvvrtvgnaqqspmsygrliglisfggfvaakmmes velqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae
Timeline for d2a5ya_: