SCOPe 2.08: Domain d2a06w_: 2a06 W:

Lineage for d2a06w_ (2a06 W:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
   Uniprot P00130

8. Domain d2a06w_: 2a06 W: [125937]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_
   automated match to d1be3j_
   complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq

Details for d2a06w_

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (W:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d2a06w_:

Sequence; same for both SEQRES and ATOM records:

>d2a06w_ f.23.14.1 (W:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

Timeline for d2a06w_:

• d2a06w_ first appeared in SCOP 1.73, called d2a06w1
  
• d2a06w_ appears in SCOPe 2.07