Lineage for d1zuqb2 (1zuq B:84-198)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2553021Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2553085Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)
  8. 2553113Domain d1zuqb2: 1zuq B:84-198 [125686]
    Other proteins in same PDB: d1zuqa1, d1zuqb1
    automated match to d2p4ka2
    complexed with mn

Details for d1zuqb2

PDB Entry: 1zuq (more details), 2 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1zuqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuqb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1zuqb2:

Click to download the PDB-style file with coordinates for d1zuqb2.
(The format of our PDB-style files is described here.)

Timeline for d1zuqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zuqb1