SCOPe 2.07: Domain d1zu8a2: 1zu8 A:240-307

Lineage for d1zu8a2 (1zu8 A:240-307)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)

8. Domain d1zu8a2: 1zu8 A:240-307 [125664]
   Other proteins in same PDB: d1zu8a1
   automatically matched to d1ljya2

Details for d1zu8a2

PDB Entry: 1zu8, 3.05 Å

PDB Description: crystal structure of the goat signalling protein with a bound trisaccharide reveals that trp78 reduces the carbohydrate binding site to half

PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zu8a2:

Sequence; same for both SEQRES and ATOM records:

>d1zu8a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1zu8a2:

• d1zu8a2 first appeared in SCOP 1.73
  
• d1zu8a2 appears in SCOPe 2.06
  
• d1zu8a2 appears in the current release, SCOPe 2.08