Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.4: GAD domain-like [55261] (2 families) |
Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
Protein Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain [143513] (2 species) |
Species Pyrococcus abyssi [TaxId:29292] [143515] (1 PDB entry) Uniprot Q9V0U0 277-407 |
Domain d1zq1c2: 1zq1 C:277-407 [125494] Other proteins in same PDB: d1zq1a1, d1zq1a2, d1zq1b1, d1zq1b2, d1zq1c1, d1zq1c3, d1zq1d1, d1zq1d3 complexed with asp |
PDB Entry: 1zq1 (more details), 3 Å
SCOPe Domain Sequences for d1zq1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq1c2 d.74.4.1 (C:277-407) Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain {Pyrococcus abyssi [TaxId: 29292]} vkpkdikeefydvtdifentkskiiarvikkggkvlaiklpkfrgligreiqpgrrlgte fadrakkyvpgifhidelpnygisqeevnkvierlnlseedafvlvaaeeekaknalrev ikrareaiegv
Timeline for d1zq1c2: