Lineage for d1zofh1 (1zof H:1-170)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 700046Protein Thioredoxin reductase TsaA [142383] (1 species)
  7. 700047Species Helicobacter pylori [TaxId:210] [142384] (1 PDB entry)
  8. 700055Domain d1zofh1: 1zof H:1-170 [125446]
    automatically matched to 1ZOF A:1-170
    mutant

Details for d1zofh1

PDB Entry: 1zof (more details), 2.95 Å

PDB Description: crystal structure of alkyl hydroperoxide-reductase (ahpc) from helicobacter pylori
PDB Compounds: (H:) alkyl hydroperoxide-reductase

SCOP Domain Sequences for d1zofh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zofh1 c.47.1.10 (H:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]}
mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv
kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea
ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcp

SCOP Domain Coordinates for d1zofh1:

Click to download the PDB-style file with coordinates for d1zofh1.
(The format of our PDB-style files is described here.)

Timeline for d1zofh1: