Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [186917] (2 PDB entries) |
Domain d1zofc_: 1zof C: [125441] Other proteins in same PDB: d1zofa1 automated match to d1qmva_ |
PDB Entry: 1zof (more details), 2.95 Å
SCOPe Domain Sequences for d1zofc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zofc_ c.47.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]} mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcp
Timeline for d1zofc_: