Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.1: Formyltransferase [53329] (5 proteins) |
Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species) |
Species Clostridium thermocellum [TaxId:1515] [117677] (1 PDB entry) Uniprot Q4HJX2 47% sequence identity Structural genomics target; GI:67850689 |
Domain d1zgha2: 1zgh A:1-164 [125029] Other proteins in same PDB: d1zgha1 complexed with unx |
PDB Entry: 1zgh (more details), 2.05 Å
SCOPe Domain Sequences for d1zgha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} mniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswii pkeifenftcvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrdl dlygtaeeifmraskiifndmipelltkrpvpqkqegeatvfqr
Timeline for d1zgha2: