Lineage for d1zgha2 (1zgh A:1-164)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378380Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 1378381Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 1378382Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 1378442Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species)
  7. 1378443Species Clostridium thermocellum [TaxId:1515] [117677] (1 PDB entry)
    Uniprot Q4HJX2 47% sequence identity
    Structural genomics target; GI:67850689
  8. 1378444Domain d1zgha2: 1zgh A:1-164 [125029]
    Other proteins in same PDB: d1zgha1
    complexed with unx

Details for d1zgha2

PDB Entry: 1zgh (more details), 2.05 Å

PDB Description: methionyl-trna formyltransferase from clostridium thermocellum
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d1zgha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]}
mniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswii
pkeifenftcvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrdl
dlygtaeeifmraskiifndmipelltkrpvpqkqegeatvfqr

SCOPe Domain Coordinates for d1zgha2:

Click to download the PDB-style file with coordinates for d1zgha2.
(The format of our PDB-style files is described here.)

Timeline for d1zgha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgha1