Lineage for d1z4ma_ (1z4m A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1628841Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 1628848Protein automated matches [190171] (2 species)
    not a true protein
  7. 1628849Species Human (Homo sapiens) [TaxId:9606] [186899] (15 PDB entries)
  8. 1628859Domain d1z4ma_: 1z4m A: [124437]
    automated match to d1q92a_
    complexed with gol, mg, u5p

Details for d1z4ma_

PDB Entry: 1z4m (more details), 1.7 Å

PDB Description: structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d1z4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4ma_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

SCOPe Domain Coordinates for d1z4ma_:

Click to download the PDB-style file with coordinates for d1z4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1z4ma_: