Lineage for d1z2la1 (1z2l A:4-212,A:330-413)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497538Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2497539Protein Allantoate amidohydrolase AllC catalytic domain [142514] (1 species)
  7. 2497540Species Escherichia coli [TaxId:562] [142515] (2 PDB entries)
    Uniprot P77425 2-210,328-411
  8. 2497541Domain d1z2la1: 1z2l A:4-212,A:330-413 [124383]
    Other proteins in same PDB: d1z2la2, d1z2la3, d1z2lb2, d1z2lb3
    complexed with 1al, so4, zn

Details for d1z2la1

PDB Entry: 1z2l (more details), 2.25 Å

PDB Description: crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate
PDB Compounds: (A:) Allantoate amidohydrolase

SCOPe Domain Sequences for d1z2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2la1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]}
ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgn
lygrlngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevv
amaeeegsrfpyvfwgsknifglanpddvrnicdakgnsfvdamkacgftlpnapltprq
dikafvelhieqgcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgag
hdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawqk

SCOPe Domain Coordinates for d1z2la1:

Click to download the PDB-style file with coordinates for d1z2la1.
(The format of our PDB-style files is described here.)

Timeline for d1z2la1: