Lineage for d1z1bb2 (1z1b B:74-356)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681007Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1681008Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1681009Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 1681080Protein Integrase (Int) [56353] (1 species)
  7. 1681081Species Bacteriophage lambda [TaxId:10710] [56354] (5 PDB entries)
  8. 1681089Domain d1z1bb2: 1z1b B:74-356 [124349]
    Other proteins in same PDB: d1z1ba1, d1z1bb1
    automatically matched to d1p7da_
    protein/DNA complex

Details for d1z1bb2

PDB Entry: 1z1b (more details), 3.8 Å

PDB Description: crystal structure of a lambda integrase dimer bound to a coc' core site
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1z1bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1bb2 d.163.1.1 (B:74-356) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
vtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik

SCOPe Domain Coordinates for d1z1bb2:

Click to download the PDB-style file with coordinates for d1z1bb2.
(The format of our PDB-style files is described here.)

Timeline for d1z1bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z1bb1