SCOPe 2.03: Domain d1yykb2: 1yyk B:151-220

Lineage for d1yykb2 (1yyk B:151-220)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)

8. Domain d1yykb2: 1yyk B:151-220 [124221]
   Other proteins in same PDB: d1yyka1, d1yykb1
   automatically matched to d1rc7a2
   protein/RNA complex; complexed with trs

Details for d1yykb2

PDB Entry: 1yyk, 2.5 Å

PDB Description: Crystal structure of RNase III from Aquifex Aeolicus complexed with double-stranded RNA at 2.5-angstrom resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yykb2:

Sequence; same for both SEQRES and ATOM records:

>d1yykb2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

Timeline for d1yykb2:

• d1yykb2 first appeared in SCOP 1.73
  
• d1yykb2 appears in SCOPe 2.02
  
• d1yykb2 appears in SCOPe 2.04
  
• d1yykb2 appears in the current release, SCOPe 2.08