Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Arthrobacter sp. c2-2 [TaxId:192168] [141065] (1 PDB entry) Uniprot Q8KRF6 220-312! Uniprot Q8KRF6 610-721 |
Domain d1yq2b2: 1yq2 B:220-312 [123849] Other proteins in same PDB: d1yq2a3, d1yq2a4, d1yq2a5, d1yq2b3, d1yq2b4, d1yq2b5, d1yq2c3, d1yq2c4, d1yq2c5, d1yq2d3, d1yq2d4, d1yq2d5, d1yq2e3, d1yq2e4, d1yq2e5, d1yq2f3, d1yq2f4, d1yq2f5 automated match to d1yq2a2 complexed with cl, mg, na, peg, so4 |
PDB Entry: 1yq2 (more details), 1.9 Å
SCOPe Domain Sequences for d1yq2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq2b2 b.1.4.1 (B:220-312) beta-Galactosidase, domains 2 and 4 {Arthrobacter sp. c2-2 [TaxId: 192168]} ggitdawlrtgwsarsgagtgtidpeitadatafpvtlsvpelgvnvtwksaeevaplal envepwsaevprlyeasvssaaesisvrlgfrt
Timeline for d1yq2b2:
View in 3D Domains from same chain: (mouse over for more information) d1yq2b1, d1yq2b3, d1yq2b4, d1yq2b5 |