SCOP 1.73: Domain d1yn7a1: 1yn7 A:182-274

Lineage for d1yn7a1 (1yn7 A:182-274)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1yn7a1: 1yn7 A:182-274 [123715]
   Other proteins in same PDB: d1yn7a2, d1yn7b1
   automatically matched to d1ddha1
   mutant

Details for d1yn7a1

PDB Entry: 1yn7, 2.2 Å

PDB Description: crystal structure of a mouse mhc class i protein, h2-db, in complex with a mutated peptide (r7a) of the influenza a acid polymerase

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1yn7a1:

Sequence; same for both SEQRES and ATOM records:

>d1yn7a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1yn7a1:

• d1yn7a1 is new in SCOP 1.73
  
• d1yn7a1 appears in SCOP 1.75
  
• d1yn7a1 appears in the current release, SCOPe 2.08