Lineage for d1yijy1 (1yij Y:95-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851574Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2851575Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2851576Protein Ribosomal protein L32e [52044] (1 species)
  7. 2851577Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2851599Domain d1yijy1: 1yij Y:95-236 [123322]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijz1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijy1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1yijy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1yijy1:

Click to download the PDB-style file with coordinates for d1yijy1.
(The format of our PDB-style files is described here.)

Timeline for d1yijy1: