Lineage for d1yi5b1 (1yi5 B:2-205)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428810Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2428811Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2428904Domain d1yi5b1: 1yi5 B:2-205 [123257]
    Other proteins in same PDB: d1yi5f1, d1yi5g1, d1yi5h1, d1yi5i1, d1yi5j1
    automatically matched to d1uw6a_

Details for d1yi5b1

PDB Entry: 1yi5 (more details), 4.2 Å

PDB Description: Crystal structure of the a-cobratoxin-AChBP complex
PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d1yi5b1:

Sequence, based on SEQRES records: (download)

>d1yi5b1 b.96.1.1 (B:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d1yi5b1 b.96.1.1 (B:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttnsddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1yi5b1:

Click to download the PDB-style file with coordinates for d1yi5b1.
(The format of our PDB-style files is described here.)

Timeline for d1yi5b1: