Lineage for d1ychd2 (1ych D:2-250)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603336Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 2603337Protein Nitric oxide reductase N-terminal domain [143914] (2 species)
  7. 2603341Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
    Uniprot Q9FDN7 2-250
  8. 2603349Domain d1ychd2: 1ych D:2-250 [122964]
    Other proteins in same PDB: d1ycha1, d1ychb1, d1ychc1, d1ychd1
    automated match to d1ycfa2
    complexed with feo, fmn, zn

Details for d1ychd2

PDB Entry: 1ych (more details), 2.8 Å

PDB Description: x-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
PDB Compounds: (D:) Nitric oxide reductase

SCOPe Domain Sequences for d1ychd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ychd2 d.157.1.3 (D:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

SCOPe Domain Coordinates for d1ychd2:

Click to download the PDB-style file with coordinates for d1ychd2.
(The format of our PDB-style files is described here.)

Timeline for d1ychd2: