Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins) |
Protein Nitric oxide reductase N-terminal domain [143914] (2 species) |
Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries) Uniprot Q9FDN7 2-250 |
Domain d1ycgd2: 1ycg D:2-250 [122956] Other proteins in same PDB: d1ycga1, d1ycgb1, d1ycgc1, d1ycgd1 automated match to d1ycfa2 complexed with edo, feo, fmn, zn |
PDB Entry: 1ycg (more details), 2.8 Å
SCOPe Domain Sequences for d1ycgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycgd2 d.157.1.3 (D:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie ayarwaegq
Timeline for d1ycgd2: