Lineage for d1y3ab2 (1y3a B:34-60,B:182-344)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595281Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1595306Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)
  8. 1595314Domain d1y3ab2: 1y3a B:34-60,B:182-344 [122585]
    Other proteins in same PDB: d1y3aa1, d1y3ab1, d1y3ac1, d1y3ad1
    automatically matched to d1kjya2
    complexed with gdp

Details for d1y3ab2

PDB Entry: 1y3a (more details), 2.5 Å

PDB Description: structure of g-alpha-i1 bound to a gdp-selective peptide provides insight into guanine nucleotide exchange
PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1y3ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ab2 c.37.1.8 (B:34-60,B:182-344) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvii

SCOPe Domain Coordinates for d1y3ab2:

Click to download the PDB-style file with coordinates for d1y3ab2.
(The format of our PDB-style files is described here.)

Timeline for d1y3ab2: