Lineage for d1y3aa1 (1y3a A:61-181)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330344Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2330345Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2330346Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2330347Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2330372Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)
  8. 2330379Domain d1y3aa1: 1y3a A:61-181 [122582]
    Other proteins in same PDB: d1y3aa2, d1y3ab2, d1y3ac2, d1y3ad2
    automatically matched to d1kjya1
    complexed with gdp

Details for d1y3aa1

PDB Entry: 1y3a (more details), 2.5 Å

PDB Description: structure of g-alpha-i1 bound to a gdp-selective peptide provides insight into guanine nucleotide exchange
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1y3aa1:

Sequence, based on SEQRES records: (download)

>d1y3aa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records): (download)

>d1y3aa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

SCOPe Domain Coordinates for d1y3aa1:

Click to download the PDB-style file with coordinates for d1y3aa1.
(The format of our PDB-style files is described here.)

Timeline for d1y3aa1: